Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

P36561

Expression Region

1-247

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGESILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ERH Antibody, Affinity Purified
A305-402A 100 µg

Rabbit anti-ERH Antibody, Affinity Purified

Sign In for Pricing
View Details
Rsph3a Protein Vector (Mouse) (pPB-N-His)
PV225959 500 ng

Rsph3a Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human TSPAN31 shRNA Plasmid
abx954246-01 150 µg

Human TSPAN31 shRNA Plasmid

Sign In for Pricing
View Details
Human TSPAN31 shRNA Plasmid
abx954246-02 300 µg

Human TSPAN31 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Escherichia coli Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS1073548 Inquire

Recombinant Escherichia coli Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Sign In for Pricing
View Details
Acat3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
11152154 3x 1.0 µg DNA

Acat3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details