Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Raja ocellata Gap junction delta-2 protein

This Recombinant Raja ocellata Gap junction delta-2 protein spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-35, Cx35, Gap junction alpha-9 protein

UniProt

P69999

Expression Region

1-302

Origin

Raja ocellata (Skate)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILVVAIVGETVYDDEQTMFVCNTLQP GCNQACYDKAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSSKQRERQYSTVFITLDKDK KREDNKIKNTTVNGVLQNSEFFTKEMQSDFLEVKEMQNSAARNSKMSKIRRQEGISRFYI IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKMVECYVSRPTEKTVFLVFMFAV SGLCVILNLAELNHLGWRKIKTAVRGAQERRKSIYEIRNKDSPHRIGVPNFGRTQSSDSA YV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51 Rabbit Polyclonal Antibody
TA367217 100 µL

RAD51 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPS21P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV784012 1.0 µg DNA

RPS21P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
AAV-293 Cell Line
RWT-934 1x 10^6

AAV-293 Cell Line

Sign In for Pricing
View Details
NECAP1 3'UTR Lenti-reporter-Luc Vector
31679081 1.0 µg

NECAP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral human C11orf74 shRNA (UAS) - Lentiviral human C11orf74 shRNA (UAS, RFP) (100)
GTR15129756 1 Vial

Lentiviral human C11orf74 shRNA (UAS) - Lentiviral human C11orf74 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MYL12B Adenovirus (Human)
31246051 1.0 mL

MYL12B Adenovirus (Human)

Sign In for Pricing
View Details