Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Raja ocellata Gap junction delta-2 protein

This Recombinant Raja ocellata Gap junction delta-2 protein spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-35, Cx35, Gap junction alpha-9 protein

UniProt

P69999

Expression Region

1-302

Origin

Raja ocellata (Skate)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILVVAIVGETVYDDEQTMFVCNTLQP GCNQACYDKAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSSKQRERQYSTVFITLDKDK KREDNKIKNTTVNGVLQNSEFFTKEMQSDFLEVKEMQNSAARNSKMSKIRRQEGISRFYI IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKMVECYVSRPTEKTVFLVFMFAV SGLCVILNLAELNHLGWRKIKTAVRGAQERRKSIYEIRNKDSPHRIGVPNFGRTQSSDSA YV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDRD3 Polyclonal Antibody
E-AB-67718-01 60 µL

TDRD3 Polyclonal Antibody

Sign In for Pricing
View Details
TDRD3 Polyclonal Antibody
E-AB-67718-02 120 µL

TDRD3 Polyclonal Antibody

Sign In for Pricing
View Details
TDRD3 Polyclonal Antibody
E-AB-67718-03 200 µL

TDRD3 Polyclonal Antibody

Sign In for Pricing
View Details
PCNA Detection Antibody
OAOA22350-50UG 50 µg

PCNA Detection Antibody

Sign In for Pricing
View Details
Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Antibody (FITC)
abx344936-01 50 µL

Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Antibody (FITC)

Sign In for Pricing
View Details
Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Antibody (FITC)
abx344936-02 100 µL

Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Antibody (FITC)

Sign In for Pricing
View Details