Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Raja ocellata Gap junction delta-2 protein

This Recombinant Raja ocellata Gap junction delta-2 protein spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-35, Cx35, Gap junction alpha-9 protein

UniProt

P69999

Expression Region

1-302

Origin

Raja ocellata (Skate)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILVVAIVGETVYDDEQTMFVCNTLQP GCNQACYDKAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSSKQRERQYSTVFITLDKDK KREDNKIKNTTVNGVLQNSEFFTKEMQSDFLEVKEMQNSAARNSKMSKIRRQEGISRFYI IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKMVECYVSRPTEKTVFLVFMFAV SGLCVILNLAELNHLGWRKIKTAVRGAQERRKSIYEIRNKDSPHRIGVPNFGRTQSSDSA YV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Galectin-1
7-00429 1 mg

Recombinant Human Galectin-1

Sign In for Pricing
View Details
Bovine N-acyl phosphatidylethanolamine phospholipase D ELISA Kit
OM618274 96 Strip Well

Bovine N-acyl phosphatidylethanolamine phospholipase D ELISA Kit

Sign In for Pricing
View Details
APITD1 Protein Vector (Mouse) (pPM-C-His)
PV155189 500 ng

APITD1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Granzyme B (GZMB) ELISA Kit
MBS459773-01 48 Tests

Mouse Granzyme B (GZMB) ELISA Kit

Sign In for Pricing
View Details
Mouse Granzyme B (GZMB) ELISA Kit
MBS459773-02 96 Tests

Mouse Granzyme B (GZMB) ELISA Kit

Sign In for Pricing
View Details
Mouse Granzyme B (GZMB) ELISA Kit
MBS459773-03 5x 96 Tests

Mouse Granzyme B (GZMB) ELISA Kit

Sign In for Pricing
View Details