Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant High osmolarity signaling protein SHO1B (SHO1B)

This Recombinant High osmolarity signaling protein SHO1B (SHO1B) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

High osmolarity signaling protein SHO1B, Osmosensor SHO1B

UniProt

D6PVB5

Expression Region

1-320

Origin

Hortaea werneckii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYNNNRYGGGGGAGSKFNLGHIVGDPFSLATIAIATAGWLIAFVSSIIANIDQEYPNYS WWALAYMFFVILGVTLAVAANAVYTYHVAMVGFLAAGLVFTTSSVNSLIYWSDKAKQAAA AGFILLSMVSIVWIFYFGSQPTASHRQTIDSFALHKDHAPSRASRHMTQSYRPETTHSAQ HPQMYNSSQLAGFETSSPVTGYPGGAAGATTKRESASAFPQPGQGGNFPNNQQPITSHTQ QQQQQSQDLTSPAATAHPPTEYPYRAKAIYSYEANPDDANEISFHKHEILEVSDVSGRWW QAKKENGETGIAPSNYLILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-100 1x 100 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details