Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis D (2) dopamine receptor B

This Recombinant Xenopus laevis D (2) dopamine receptor B spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

D (2) dopamine receptor B, D2R-B, D2R 2

UniProt

P34973

Expression Region

1-345

Origin

Xenopus laevis (African clawed frog)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISV VWVLSFAISCPLLFGLNNTASTVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRK RRKRVNTKRNSHGVGVDAHKDKCTHPEDVKLCAVFVKSNGSFPAEKKKVEAGNHPEDMEM EMMSSTSPPEKTKHKSASPEHQLAVPATSNQCNNVNLPTPVNSPYKAENNGHSKDSTQPA KVFEIQSMPNGKTRTSIKTMSKRKISQHKEKKATQMLAIVLGVFIICWLPFFITHILNMH CNCNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF594 conjugate, 0.1mg/mL
BNC940597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details