Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans pH-response regulator protein palI/RIM9 (RIM9)

This Recombinant Candida albicans pH-response regulator protein palI/RIM9 (RIM9) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

PH-response regulator protein palI/RIM9

UniProt

Q59WV0

Expression Region

1-346

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKAFIALLILLIVCWVIQLLPVIAVPFTTPDANIYLSYYNNYRFGVFGICNVERHICSK PSIGYPSTNSTFYAYDNDESFGTGGIVLPSDVRYTISKLLVVHVVAFCFSSLLLIVIFGL IIILFFKYIKTKKDLEDIQLNDSSHEITIHSDEEDNNNNNIDNTNHNNKRASVTINKTIF DLTPFLNLMLVFTFFSVLTTLLAFLADILLFTPNLSYLGWLQLIPIVSMALVTSMLCFIE RSISSRKFFESEYRYANDDMRIMRKTYVDEFWNDNASDDGFYVYTDGFYTRNGDNVQQPT SNTAGSLLSEHHDVSIVEPRTFLDTDDSRRGSSPHEFIELQNLRPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-500 1x 500 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF647 conjugate, 0.1mg/mL
BNC472808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL
BNC882156-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details