Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis UPF0421 protein OB2406 (OB2406)

This Recombinant Oceanobacillus iheyensis UPF0421 protein OB2406 (OB2406) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

UPF0421 protein OB2406

UniProt

Q8ENS1

Expression Region

1-346

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLRSFIGSRVIKTGIAVLLTAYICEWIGWSPVFAVITAIVTIEPTVSDSIRKGLIRFPA SAIGAAYAVLFIALFGNSPVTYALSAVFTITTCFRLKLHDGLLVATITSVAMVDVIHSNY VMEFFIRLFTTTIGLSVSTLVNMFLLPPDYQKNIQTKVSSIAQELGKQIQGIYYCLLHVD EINNESKYLDKLLELDKLIIRAEILSRYQTNDSKYHFTENNQEKFKDIKTQLHFLRIMHY HLTNVIDHPKEQINIDEKEKNELLNVSSYIAQVLKKELAYNSDDIQDKRTRLNELFWKEK HRTHNLSSDMLNKLPFELVMLYELISILELTEDYFYTANLHKENAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF640R conjugate, 0.1mg/mL
BNC401860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details