Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peripherin-2 (Prph2)

This Recombinant Rat Peripherin-2 (Prph2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P17438

Expression Region

1-346

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVLFSLGLFLKIELRKRSDVMDNSESHFV PNSLIGVGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKLYLAVCVFFNVILFLVALCCF LLRGSLESTLAYGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT EELNLWLRGCRAALLNYYSSLMNSMGVVTLLIWLFEVSITAGLRFLHTALESVSNPEDPE CESEGWLLENSVSETWKAFLESFKKLGKSNQVEAEAADAGQAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KISS1 3'UTR Luciferase Stable Cell Line
TU011814 1.0 mL

KISS1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-NECTIN4 Polyclonal Antibody
HV985014-01 50 µg

Anti-NECTIN4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-NECTIN4 Polyclonal Antibody
HV985014-02 100 µg

Anti-NECTIN4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Giardia lamblia DDX6 GL50803_2098 Antibody-iFluor647 Conjugate
DZ03826-iFluor647 200 µL

Anti-Giardia lamblia DDX6 GL50803_2098 Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r198 shRNA (UAS) - Lentiviral mouse Vmn1r198 shRNA (UAS, RFP) (25)
GTR15173627 1 Vial

Lentiviral mouse Vmn1r198 shRNA (UAS) - Lentiviral mouse Vmn1r198 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human SEPW1 Protein
orb428379-01 5 µg

Human SEPW1 Protein

Sign In for Pricing
View Details