Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peripherin-2 (Prph2)

This Recombinant Mouse Peripherin-2 (Prph2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P15499

Expression Region

1-346

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVLFSLGLFLKIELRKRSEVMNNSESHFV PNSLIGVGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCIFFNVILFLVALCCF LLRGSLESTLAYGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT EELNLWLRGCRAALLNYYSSLMNSMGVVTLLVWLFEVSITAGLRYLHTALESVSNPEDPE CESEGWLLEKSVPETWKAFLESFKKLGKSNQVEAEGADAGPAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRC Rabbit pAb, IRDye 800CW conjugated
orb2825666 100 µL

SRC Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Lentiviral human TRIP6 shRNA (UAS) - Lentiviral human TRIP6 shRNA (UAS, RFP) (100)
GTR15103068 1 Vial

Lentiviral human TRIP6 shRNA (UAS) - Lentiviral human TRIP6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RNF31 Protein Vector (Human) (pPB-C-His)
PV035565 500 ng

RNF31 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Sapphire pipettor 500 - 5000 μl, single channel, 1 piece per CAR
89000500 1 piece per CAR

Sapphire pipettor 500 - 5000 μl, single channel, 1 piece per CAR

Sign In for Pricing
View Details
BOP1 (NM_015201) Human Over-expression Lysate
LS023246 100 µg

BOP1 (NM_015201) Human Over-expression Lysate

Sign In for Pricing
View Details
rno-miR-1297 miRNA Antagomir
MBS8321161-01 10 nmol

rno-miR-1297 miRNA Antagomir

Sign In for Pricing
View Details