Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peripherin-2 (Prph2)

This Recombinant Mouse Peripherin-2 (Prph2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P15499

Expression Region

1-346

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVLFSLGLFLKIELRKRSEVMNNSESHFV PNSLIGVGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCIFFNVILFLVALCCF LLRGSLESTLAYGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT EELNLWLRGCRAALLNYYSSLMNSMGVVTLLVWLFEVSITAGLRYLHTALESVSNPEDPE CESEGWLLEKSVPETWKAFLESFKKLGKSNQVEAEGADAGPAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPEB3 Protein Vector (Human) (pPB-N-His)
PV010478 500 ng

CPEB3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Anti-RPL5 Antibody Picoband®, Dylight550 Conjugate
A02843-2-Dylight550 100 µg

Anti-RPL5 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)
MBS2163563-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)
MBS2163563-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)
MBS2163563-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)
MBS2163563-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Vitamin B2 (VB2)

Sign In for Pricing
View Details