Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peripherin-2 (PRPH2)

This Recombinant Human Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein, Tetraspanin-22, Tspan-22

UniProt

P23942

Expression Region

1-346

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIGMGVLSCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCF LLRGSLENTLGQGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQT EELNLWVRGCRAALLSYYSSLMNSMGVVTLLIWLFEVTITIGLRYLQTSLDGVSNPEESE SESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TruB Antibody
orb834692 2 mg

TruB Antibody

Sign In for Pricing
View Details
Human ETV3 siRNA
abx915746-01 15 nmol

Human ETV3 siRNA

Sign In for Pricing
View Details
Human ETV3 siRNA
abx915746-02 30 nmol

Human ETV3 siRNA

Sign In for Pricing
View Details
D17Wsu92e (NM_001044719) Mouse Tagged ORF Clone
MG222764 10 µg

D17Wsu92e (NM_001044719) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
mmu-miR-6980-3p miRNA Agomir
MBS8314712-01 5 nmol

mmu-miR-6980-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6980-3p miRNA Agomir
MBS8314712-02 10 nmol

mmu-miR-6980-3p miRNA Agomir

Sign In for Pricing
View Details