Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Peripherin-2 (PRPH2)

This Recombinant Cat Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P35906

Expression Region

1-346

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIGMGVLSCVFNSLAGKICYDALDPSKYAKWKPWLKSYLVVCVLFNIVLFLVALCCF LMRGSLESTLAQGLKNGMKYYRDTDTPGRCFMKKTIDLLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQT EELNLWVRGCRAALLSYYGSLMNSMGAVTLLVWLFEVSITIGLRYLHTALEGVSNPEDLE CESEGWLLEKSVSETWKAFLESLKKLGKSNQVEAEGADAGQAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycobacterium tuberculosis (M. tuberculosis, Putative Virulence-Regulating 38kD Protein, virS, Rv3082c, MT3167, MTV013.03c) (PE)
MBS6252057-01 0.1 mL

Mycobacterium tuberculosis (M. tuberculosis, Putative Virulence-Regulating 38kD Protein, virS, Rv3082c, MT3167, MTV013.03c) (PE)

Sign In for Pricing
View Details
Mycobacterium tuberculosis (M. tuberculosis, Putative Virulence-Regulating 38kD Protein, virS, Rv3082c, MT3167, MTV013.03c) (PE)
MBS6252057-02 5x 0.1 mL

Mycobacterium tuberculosis (M. tuberculosis, Putative Virulence-Regulating 38kD Protein, virS, Rv3082c, MT3167, MTV013.03c) (PE)

Sign In for Pricing
View Details
Drap 1/P28 (Recombinant)
TA-300-1 2 µg

Drap 1/P28 (Recombinant)

Sign In for Pricing
View Details
Matrilin-4 (B-1) Alexa Fluor® 790
sc-374652 AF790 200 µg/mL

Matrilin-4 (B-1) Alexa Fluor® 790

Sign In for Pricing
View Details
Alpha Synuclein 1-60 Human Recombinant (SNCA 1-60 Human)
PT_72273-01 10 µg

Alpha Synuclein 1-60 Human Recombinant (SNCA 1-60 Human)

Sign In for Pricing
View Details
Alpha Synuclein 1-60 Human Recombinant (SNCA 1-60 Human)
PT_72273-02 50 µg

Alpha Synuclein 1-60 Human Recombinant (SNCA 1-60 Human)

Sign In for Pricing
View Details