Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Peripherin-2 (PRPH2)

This Recombinant Cat Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P35906

Expression Region

1-346

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIGMGVLSCVFNSLAGKICYDALDPSKYAKWKPWLKSYLVVCVLFNIVLFLVALCCF LMRGSLESTLAQGLKNGMKYYRDTDTPGRCFMKKTIDLLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQT EELNLWVRGCRAALLSYYGSLMNSMGAVTLLVWLFEVSITIGLRYLHTALEGVSNPEDLE CESEGWLLEKSVSETWKAFLESLKKLGKSNQVEAEGADAGQAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLDN Adenovirus (Rat)
36968056 1.0 mL

PLDN Adenovirus (Rat)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)
MBS1344993-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)
MBS1344993-02 0.1 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)
MBS1344993-03 0.02 mg (Yeast)

Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)
MBS1344993-04 0.1 mg (Yeast)

Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)
MBS1344993-05 0.02 mg (Baculovirus)

Recombinant Yersinia pseudotuberculosis Cell division topological specificity factor (minE)

Sign In for Pricing
View Details