Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Peripherin-2 (PRPH2)

This Recombinant Cat Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P35906

Expression Region

1-346

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIGMGVLSCVFNSLAGKICYDALDPSKYAKWKPWLKSYLVVCVLFNIVLFLVALCCF LMRGSLESTLAQGLKNGMKYYRDTDTPGRCFMKKTIDLLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQT EELNLWVRGCRAALLSYYGSLMNSMGAVTLLVWLFEVSITIGLRYLHTALEGVSNPEDLE CESEGWLLEKSVSETWKAFLESLKKLGKSNQVEAEGADAGQAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTX4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2798207 1.0 µg DNA

PTX4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Transition Protein 1 (TNP1) Magnetic Fluorescence Assay Kit
MBS2155320-01 96 Tests

Transition Protein 1 (TNP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Transition Protein 1 (TNP1) Magnetic Fluorescence Assay Kit
MBS2155320-02 5x 96 Tests

Transition Protein 1 (TNP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Transition Protein 1 (TNP1) Magnetic Fluorescence Assay Kit
MBS2155320-03 10x 96 Tests

Transition Protein 1 (TNP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
VTI1B antibody
70R-21286 50 μL

VTI1B antibody

Sign In for Pricing
View Details
Research Grade Anti-Human SNCA/Alpha-synuclein (ABL301)
HW755066-01 100 µg

Research Grade Anti-Human SNCA/Alpha-synuclein (ABL301)

Sign In for Pricing
View Details