Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Peripherin-2 (PRPH2)

This Recombinant Dog Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P52204

Expression Region

1-346

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIVMGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCVLFNIALFLVTLCCF LMRGSLESTLAHGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFRCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT EELNLWVNGCRAALLSYYSSLMNSMGAVTLLVWLFEVTITIGLRYLHTALEGVSNPEDPE CESEGWLLEKSVSETWKAFLESLKKLGKSNQVEAEGADAGQAPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klf10 Mouse Pre-designed siRNA Set A
HY-RS19210 1 Set

Klf10 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
RGS4 Rabbit pAb, BF700 conjugated
orb2884887 100 µL

RGS4 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Human DEDD Recombinant Protein
PROTO75618-100ug 100 µg

Human DEDD Recombinant Protein

Sign In for Pricing
View Details
Bovine Serine/threonine-protein kinase 25, STK25 ELISA Kit
MBS9337761-01 48 Well

Bovine Serine/threonine-protein kinase 25, STK25 ELISA Kit

Sign In for Pricing
View Details
Bovine Serine/threonine-protein kinase 25, STK25 ELISA Kit
MBS9337761-02 96 Well

Bovine Serine/threonine-protein kinase 25, STK25 ELISA Kit

Sign In for Pricing
View Details
Bovine Serine/threonine-protein kinase 25, STK25 ELISA Kit
MBS9337761-03 5x 96 Well

Bovine Serine/threonine-protein kinase 25, STK25 ELISA Kit

Sign In for Pricing
View Details