Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Peripherin-2 (prph2)

This Recombinant Xenopus laevis Peripherin-2 (prph2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein, xRDS38

UniProt

O42583

Expression Region

1-346

Origin

Xenopus laevis (African clawed frog)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALMKTKFNLKRRVKLAQGLWLMNWCCVLAGIALFSMGVFLKIELRKRSEVMDNDESHFV PNSLILMGSLACALNAFPGKICYDSLDPTKFPRWKPMLKPYLIICLIFNIFIFFTGVVCF LTRGSLESTLAHGLKNGMRYYKDTDIPGRCFLKKTIDLLQIEFKCCGNNGFRDWFELQWV SNRYLGGRSKEVKDRIQSNVDGKYLIDGVPFSCCNPSSPRPCIQLQVTNNSAHYSYDHQT EELNLWSKGCKEALLNYYTSMMSSMGGMVFLVWIMEMAVMIGLRFLHTCLETIANPEDPE CESEGWILEKSLKDTIKSSWELVKSMGKLNKVETAGGEEAGVATVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAT-2 Polyclonal Antibody
RA24404-01 50 µL

EAT-2 Polyclonal Antibody

Sign In for Pricing
View Details
EAT-2 Polyclonal Antibody
RA24404-02 100 µL

EAT-2 Polyclonal Antibody

Sign In for Pricing
View Details
LMBRD1 siRNA (Mouse)
MBS8209326-01 15 nmol

LMBRD1 siRNA (Mouse)

Sign In for Pricing
View Details
LMBRD1 siRNA (Mouse)
MBS8209326-02 30 nmol

LMBRD1 siRNA (Mouse)

Sign In for Pricing
View Details
LMBRD1 siRNA (Mouse)
MBS8209326-03 5x 30 nmol

LMBRD1 siRNA (Mouse)

Sign In for Pricing
View Details
STT3A Antibody, HRP conjugated
CSB-PA022885LB01HU-01 50 µg

STT3A Antibody, HRP conjugated

Sign In for Pricing
View Details