Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Peripherin-2 (prph2)

This Recombinant Xenopus laevis Peripherin-2 (prph2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein, xRDS38

UniProt

O42583

Expression Region

1-346

Origin

Xenopus laevis (African clawed frog)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALMKTKFNLKRRVKLAQGLWLMNWCCVLAGIALFSMGVFLKIELRKRSEVMDNDESHFV PNSLILMGSLACALNAFPGKICYDSLDPTKFPRWKPMLKPYLIICLIFNIFIFFTGVVCF LTRGSLESTLAHGLKNGMRYYKDTDIPGRCFLKKTIDLLQIEFKCCGNNGFRDWFELQWV SNRYLGGRSKEVKDRIQSNVDGKYLIDGVPFSCCNPSSPRPCIQLQVTNNSAHYSYDHQT EELNLWSKGCKEALLNYYTSMMSSMGGMVFLVWIMEMAVMIGLRFLHTCLETIANPEDPE CESEGWILEKSLKDTIKSSWELVKSMGKLNKVETAGGEEAGVATVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Angiopoietin-2/ANG2 protein (His tag)
PDEB100003-01 20 µg

Recombinant Bovine Angiopoietin-2/ANG2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Bovine Angiopoietin-2/ANG2 protein (His tag)
PDEB100003-02 100 µg

Recombinant Bovine Angiopoietin-2/ANG2 protein (His tag)

Sign In for Pricing
View Details
CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPK-01231-01 5 µg

CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPK-01231-02 10 µg

CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPK-01231-03 20 µg

CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPK-01231-04 50 µg

CLEC2D Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details