Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrobaculum islandicum Protease HtpX homolog (htpX)

This Recombinant Pyrobaculum islandicum Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A1RT82

Expression Region

1-347

Origin

Pyrobaculum islandicum (strain DSM 4184 / JCM 9189)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFPIFDPIAFGLYLLGYIVMIIVAVVIAPKVASSISGRFTLYGAMALTAVLIVLTTAFVI YLIAIVAAPALAEYGWGFILGMIFFVVLMNLITYIASPFLINVTYGARPDPRLQEIVDAV ASRLGAPFRIKAVVVDGPPNAFAYGNFLTGRYVAVTSSMLALTDKRELEAVIGHEIGHHL HRDNALMLLFGVLPSILYYLGVSSVRIALSSSNNRNNNTMLLAAVGILAVVVSFLVQLLV LAFSRLREYYADTAGAKAAGKEAMQFALAKIHKFYFSNPEAHEIISGDKFRALFIYALVN AVANPFITVTRSEIEEIKRSSYSVIQEIFSTHPPIPKRLRFLDQLQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details