Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein YIPF3 (Yipf3)

This Recombinant Mouse Protein YIPF3 (Yipf3) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Protein YIPF3, Killer lineage protein 1, YIP1 family member 3

UniProt

Q3UDR8

Expression Region

1-347

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATPAAPASGVRNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE EVDADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRPYFD VEPAQVRSRLLESMIPIKMVNFPQKVAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTL MGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIHLHA LFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVVEGI LDTLEGPNIPPMQRVPRDIPAVLPAARLPVAVINATAKAIAVTLQSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR1 Human Over-expression Lysate
orb1365102 20 µg

DR1 Human Over-expression Lysate

Sign In for Pricing
View Details
NT5DC3 Protein Vector (Human) (pPM-C-HA)
PV105172 500 ng

NT5DC3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SIRT2 Human Over-expression Lysate
orb1357114 100 µg

SIRT2 Human Over-expression Lysate

Sign In for Pricing
View Details
PSMB11 siRNA (Mouse)
MBS8237455-01 15 nmol

PSMB11 siRNA (Mouse)

Sign In for Pricing
View Details
PSMB11 siRNA (Mouse)
MBS8237455-02 30 nmol

PSMB11 siRNA (Mouse)

Sign In for Pricing
View Details
PSMB11 siRNA (Mouse)
MBS8237455-03 5x 30 nmol

PSMB11 siRNA (Mouse)

Sign In for Pricing
View Details