Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Secretory carrier-associated membrane protein 3 (SCAMP3)

This Recombinant Bovine Secretory carrier-associated membrane protein 3 (SCAMP3) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Secretory carrier-associated membrane protein 3, Secretory carrier membrane protein 3

UniProt

Q58DR5

Expression Region

1-347

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQGRDGGNPFAEPGELDNPFQDPAVIQHRPSTHYATLDVYNPFETREPPPSYEPPAPVP IAPPSAPPLQSSRKLSPTEPKNYGSYSTQASTAAATAELLKKQEELNRKAEELDRREREL QHAALGSTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLL NFLACLASFCVETSNGSGFGLSILWILLFTPCSFVCWYRPMYKAFRSDSSSNFFVFFFIF FVQDVLFVLQAIGIPGWGFSGWISALVVLKVNTAVAVLMLLVALFFTGIAVLGIVMLKRI HSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-100 1x 100 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details