Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein YIPF3 (Yipf3)

This Recombinant Rat Protein YIPF3 (Yipf3) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Protein YIPF3, Liver regeneration-related protein LRRGT00110, YIP1 family member 3

UniProt

Q6TUD4

Expression Region

1-347

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATQAAPASGVRNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE EVDADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASKAFSLYANIDILRPYFD VEPAQVRSRLLESMIPIKMVNFPQKVAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTL MGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIHLHA LFYLFWLLLGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVVEGI LDTLEGPNIPPMQRVPRDIPAVLPAAKLPVAVVNATAKAIAVTLQSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSE Monoclonal Antibody, Cy3 Conjugated
bsm-60786R-Cy3 100 µL

NSE Monoclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit
MBS9325026-01 48 Well

Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit

Sign In for Pricing
View Details
Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit
MBS9325026-02 96 Well

Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit

Sign In for Pricing
View Details
Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit
MBS9325026-03 5x 96 Well

Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit

Sign In for Pricing
View Details
Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit
MBS9325026-04 10x 96 Well

Human Sperm protein associated with the nucleus on the X chromosome A, SPANXA1 ELISA Kit

Sign In for Pricing
View Details
2’-OMe-Guanosine
BUP17632 200 mg

2’-OMe-Guanosine

Sign In for Pricing
View Details