Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable palmitoyltransferase ZDHHC19 (Zdhhc19)

This Recombinant Mouse Probable palmitoyltransferase ZDHHC19 (Zdhhc19) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Probable palmitoyltransferase ZDHHC19, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 19, DHHC-19

UniProt

Q810M5

Expression Region

1-347

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFLKDAVTLVKEPQQLPSIPLSWFPSSVFAAFNVTLLLFLSGLFFGFPCRWLVQNGEWA FPAITGPLFILTFFSLVSLNFSDPGILHRGSTKEDPMTVHVVRVNQRAFRLEWCPKCLFH RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLF RTRHLPFSLDKGMAILVAVPAAGFLIPLFLLLLIQALSVSRAESSYESKCRYHPEYNPFD QGFAKNWYLAMFAPLGPNYMSEVVCLQRPVGTAWIQEKTKPSPPRRPKHCRPGPPGPQHQ PRRVPGKGPPGSGEAAALQEMRRLPASVEKSPGGPRQPTAEPAAGDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1 alpha/IL1A, C-His, Flag Tag
HA210602-01 20 µg

Human IL-1 alpha/IL1A, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-1 alpha/IL1A, C-His, Flag Tag
HA210602-02 50 µg

Human IL-1 alpha/IL1A, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-1 alpha/IL1A, C-His, Flag Tag
HA210602-03 100 µg

Human IL-1 alpha/IL1A, C-His, Flag Tag

Sign In for Pricing
View Details
NQO1 Recombinant Mouse monoclonal Antibody
HA610087 100 µg

NQO1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Mouse LEP (Leptin) ELISA Kit
E-EL-M3008-01 24 Tests

Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details
Mouse LEP (Leptin) ELISA Kit
E-EL-M3008-02 48 Tests

Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details