Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q2JTT0

Expression Region

1-348

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVVVRRSAAARRLWSWESFCQWITSTENRLYIGWFGVLMIPTLLAATFCFVIAFIAAPP VDVDGIREPVIGSLLGGNNLISAAVVPTSAAIALHFYPIWEAASLEEWLYNGGPYQLIVF HFLIGVWCYLGRQWELSYRLGMRPWIAVAFSAPAAAATAVLLVYPIGQGSFSEGLPLGIA GTFYFMLAFQAEHNILMHPASWLGVAGVFGGALLASLHGSLVISSLIRETSEEESQNAGY RFGQQEVTYNFLAGHYAFLGRLGIPSLGWRNSRSVHFWMAALPTLGIWAAAIGIGLMAFN LNGFNFNQSILDSQGRFIPTYADLLNRANLGIQAMHAPNAHHFPLLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD49b/ITGA2 Protein, N-His
orb3055996-01 50 µg

Recombinant Human CD49b/ITGA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD49b/ITGA2 Protein, N-His
orb3055996-02 100 µg

Recombinant Human CD49b/ITGA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD49b/ITGA2 Protein, N-His
orb3055996-03 1 mg

Recombinant Human CD49b/ITGA2 Protein, N-His

Sign In for Pricing
View Details
Mouse GRB10-interacting GYF protein 1, GIGYF1 ELISA KIT
E0119Mo-01 48 Well

Mouse GRB10-interacting GYF protein 1, GIGYF1 ELISA KIT

Sign In for Pricing
View Details
Mouse GRB10-interacting GYF protein 1, GIGYF1 ELISA KIT
E0119Mo-02 96 Well

Mouse GRB10-interacting GYF protein 1, GIGYF1 ELISA KIT

Sign In for Pricing
View Details
Mouse GRB10-interacting GYF protein 1, GIGYF1 ELISA KIT
E0119Mo-03 5x 96 Tests

Mouse GRB10-interacting GYF protein 1, GIGYF1 ELISA KIT

Sign In for Pricing
View Details