Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q2JTT0

Expression Region

1-348

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVVVRRSAAARRLWSWESFCQWITSTENRLYIGWFGVLMIPTLLAATFCFVIAFIAAPP VDVDGIREPVIGSLLGGNNLISAAVVPTSAAIALHFYPIWEAASLEEWLYNGGPYQLIVF HFLIGVWCYLGRQWELSYRLGMRPWIAVAFSAPAAAATAVLLVYPIGQGSFSEGLPLGIA GTFYFMLAFQAEHNILMHPASWLGVAGVFGGALLASLHGSLVISSLIRETSEEESQNAGY RFGQQEVTYNFLAGHYAFLGRLGIPSLGWRNSRSVHFWMAALPTLGIWAAAIGIGLMAFN LNGFNFNQSILDSQGRFIPTYADLLNRANLGIQAMHAPNAHHFPLLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORC2L, ID (ORC2, ORC2L, Origin recognition complex subunit 2) (Azide free) (HRP) discontinued
039504-HRP 200 µL

ORC2L, ID (ORC2, ORC2L, Origin recognition complex subunit 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
PRPS2 Antibody
MBS9521972-01 0.04 mL

PRPS2 Antibody

Sign In for Pricing
View Details
PRPS2 Antibody
MBS9521972-02 0.1 mL

PRPS2 Antibody

Sign In for Pricing
View Details
PRPS2 Antibody
MBS9521972-03 0.2 mL

PRPS2 Antibody

Sign In for Pricing
View Details
PRPS2 Antibody
MBS9521972-04 5x 0.2 mL

PRPS2 Antibody

Sign In for Pricing
View Details
Recombinant Agelena orientalis U2-agatoxin-Ao1p
MBS7086100-01 0.02 mg (E-Coli)

Recombinant Agelena orientalis U2-agatoxin-Ao1p

Sign In for Pricing
View Details