Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heterocapsa pygmaea Photosystem Q (B) protein (psbA)

This Recombinant Heterocapsa pygmaea Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9MSC1

Expression Region

1-348

Origin

Heterocapsa pygmaea (Dinoflagellate)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNTFNTSNVFANAYSFWGYVIGFILSTSNRLYIGWFGILMFPLLVLATVAYIAAFIFAP PVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFVV LHFILGAGAYMGREWEFAFRLGMRPWIFVAFSAPLVAASAVFIVYPIGQGSFSDGMPLGI SGTFNFMLVFQAEHNILMHPFHILGVAAVFGGSLFSAMHGSLVTSSLVAETAGDLSLNVG YNFGQEDETYSISAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFN LNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wheat Germ Agglutinin, CF®770 Conjugate
#29059-1 1x 1 mg

Wheat Germ Agglutinin, CF®770 Conjugate

Sign In for Pricing
View Details
hnRNP A2B1 (HNRNPA2B1) Human Gene Knockout Kit (CRISPR)
KN419318 1 Kit

hnRNP A2B1 (HNRNPA2B1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDIT4 Polyclonal Antibody
E-AB-11148-01 20 µL

DDIT4 Polyclonal Antibody

Sign In for Pricing
View Details
DDIT4 Polyclonal Antibody
E-AB-11148-02 60 µL

DDIT4 Polyclonal Antibody

Sign In for Pricing
View Details
DDIT4 Polyclonal Antibody
E-AB-11148-03 120 µL

DDIT4 Polyclonal Antibody

Sign In for Pricing
View Details
DDIT4 Polyclonal Antibody
E-AB-11148-04 200 µL

DDIT4 Polyclonal Antibody

Sign In for Pricing
View Details