Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heterocapsa pygmaea Photosystem Q (B) protein (psbA)

This Recombinant Heterocapsa pygmaea Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9MSC1

Expression Region

1-348

Origin

Heterocapsa pygmaea (Dinoflagellate)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNTFNTSNVFANAYSFWGYVIGFILSTSNRLYIGWFGILMFPLLVLATVAYIAAFIFAP PVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFVV LHFILGAGAYMGREWEFAFRLGMRPWIFVAFSAPLVAASAVFIVYPIGQGSFSDGMPLGI SGTFNFMLVFQAEHNILMHPFHILGVAAVFGGSLFSAMHGSLVTSSLVAETAGDLSLNVG YNFGQEDETYSISAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFN LNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IRF2BP2 activation kit by CRISPRa
GA117745 1 Kit

Human IRF2BP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Eotaxin 2 (CCL24) Human Gene Knockout Kit (CRISPR)
KN420724 1 Kit

Eotaxin 2 (CCL24) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DHCR7 Rabbit Polyclonal Antibody
TA361232 100 µL

DHCR7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RIOK1 (NM_031480) Human Recombinant Protein
TP320667M 100 µg

RIOK1 (NM_031480) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant TINF2 Antibody
RC-15069-01 50 μL

Recombinant TINF2 Antibody

Sign In for Pricing
View Details
Recombinant TINF2 Antibody
RC-15069-02 100 µL

Recombinant TINF2 Antibody

Sign In for Pricing
View Details