Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heterocapsa pygmaea Photosystem Q (B) protein (psbA)

This Recombinant Heterocapsa pygmaea Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9MSC1

Expression Region

1-348

Origin

Heterocapsa pygmaea (Dinoflagellate)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNTFNTSNVFANAYSFWGYVIGFILSTSNRLYIGWFGILMFPLLVLATVAYIAAFIFAP PVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFVV LHFILGAGAYMGREWEFAFRLGMRPWIFVAFSAPLVAASAVFIVYPIGQGSFSDGMPLGI SGTFNFMLVFQAEHNILMHPFHILGVAAVFGGSLFSAMHGSLVTSSLVAETAGDLSLNVG YNFGQEDETYSISAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFN LNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boceprevir Metabolite M4
TRC-B674520-2MG 2 mg

Boceprevir Metabolite M4

Sign In for Pricing
View Details
Human SLC25A21 activation kit by CRISPRa
GA113949 1 Kit

Human SLC25A21 activation kit by CRISPRa

Sign In for Pricing
View Details
GADD153 Antibody
8C0202-AAT 50 µg

GADD153 Antibody

Sign In for Pricing
View Details
UGT (UGT1A1) (NM_000463) Human Over-expression Lysate
LY424698 100 µg

UGT (UGT1A1) (NM_000463) Human Over-expression Lysate

Sign In for Pricing
View Details
Chac2 Mouse Gene Knockout Kit (CRISPR)
KN503229 1 Kit

Chac2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Azumolene Sodium Salt
TRC-A965300-5MG 5 mg

Azumolene Sodium Salt

Sign In for Pricing
View Details