Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heterocapsa rotundata Photosystem Q (B) protein (psbA)

This Recombinant Heterocapsa rotundata Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9MSC2

Expression Region

1-348

Origin

Heterocapsa rotundata (Dinoflagellate) (Amphidinium rotundatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNTFNTSNAFASAYSFWGYVIGFLLSTSNRLYIGWFGILMFPLISLATVAYIAAFIFAP PVDIDGIREPVAGALLYGNNIISGAVIPSSNAIGVHFYPVWEALGFDEWLYNGGTYQFVV LHFIFGAGAWMGREWEFAFRLGMRPWIFVAFSAPLVASCAVFVVYPIGQGSFSDGMPLGI SGTFNFMLVFQAEHNILMHPFHILGVAGVFGGSLFSAMHGSLVTSSLLAETAGDLSLNVG YNFGQEDETYSISAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFN LNGLNFNQSIIDSSGHLINSWADIVNRADLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF647 conjugate, 0.1mg/mL
BNC472419-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details