Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Flagellar biosynthetic protein flhB (flhB)

This Recombinant Aquifex aeolicus Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

O67813

Expression Region

1-350

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEEHKTERATPYKRRKVREEGNVAKSHEIASSLVVLLSLLLLLFLGTYIAKEVILIFLA VTGYVHADISELGSLYENFYENIVKVLTPLFFLALLVVILSHVAQFGFIFTLKPLSFKWE RINPFEGIKRLISLTTLFETVKNTLKAFLLIGIAVFVLKGSLYFFLSSSTYPLAETLKSF IKTSAITLITLGVVALLIAFLDYAFKRWQYEKKIMMSRRELKEEYKQLEGHPEVKSRIKA RMRELAKSRMMAEVPKATVVITNPTHIAIALKYNPEKDKAPVVVAKGKGTIAQKIVEIAE NYSIPVVRKPELARALYPAVEVGKEISPKFYKAVAEIIAYVMFKKKKVYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-100 1x 100 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL
BNC881025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details