Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative hemin transport system permease protein hrtB (hrtB)

This Recombinant Staphylococcus epidermidis Putative hemin transport system permease protein hrtB (hrtB) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Putative hemin transport system permease protein hrtB

UniProt

Q5HLN3

Expression Region

1-350

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLAWKEIKFYKFRFILIMFIIFLMAIMVLFISGLAQGLARENISIFDQIKGNQFVVQKM KEPQLEKSILSRSKQDNISKIIDEKPFKMAGKTFKINGNEENVMAINSVKNHQPNLKSGH YPKNGNQIAINEKLTAEGLYLDDKVKVKGDDTTYKVVGILKNTMYSHSNIVMMDQSKIEQ SSNVATFYVTNQLSKSDKNKINHIKGVQTATTDNITSNIASYKAEQTPLDMMIISLYIIT AIVLSAFFYVMTIQKTSEIGILKAIGITTKHLLTSLILQISMITFIGVAIAEVVILLISQ ILPVSMPFHIDMHNIIIVLVIFMIVGLIGTSLSFIKLIKIDPIEAIGGGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blood Bank Refrigerated Centrifuge BBRC-105
BBRC-105 1 Unit

Blood Bank Refrigerated Centrifuge BBRC-105

Sign In for Pricing
View Details
Human ZNF665 activation kit by CRISPRa
GA112626 1 Kit

Human ZNF665 activation kit by CRISPRa

Sign In for Pricing
View Details
MMP9 Antibody (Biotin)
KB-2623-01 50 μL

MMP9 Antibody (Biotin)

Sign In for Pricing
View Details
MMP9 Antibody (Biotin)
KB-2623-02 100 µL

MMP9 Antibody (Biotin)

Sign In for Pricing
View Details
MMP9 Antibody (Biotin)
KB-2623-03 1 mL

MMP9 Antibody (Biotin)

Sign In for Pricing
View Details
Human Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2) ELISA Kit
RDR-Rock2-Hu-01 96 Tests

Human Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2) ELISA Kit

Sign In for Pricing
View Details