Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A5GMA8

Expression Region

1-351

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDVLDDWLKRDRFVFVGWSGILLFPTAYLAIGGWLTGTTFVTSWYTH GIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWAFVALHGAFA LIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQANTFKAFEPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human YIF1B (NM_001145463) AAV Particle
RC227684A1V 250 µL

Human YIF1B (NM_001145463) AAV Particle

Sign In for Pricing
View Details
Lentiviral mouse Smim22 shRNA (UAS) - Lentiviral mouse Smim22 shRNA (UAS, GFP) plasmid
GTR15180586 1 Vial

Lentiviral mouse Smim22 shRNA (UAS) - Lentiviral mouse Smim22 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RAGE Rabbit Monoclonal Antibody
orb548205 100 µL

RAGE Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Viral MIP-II Affinity Purified Polyclonal Ab
AF601 100 µg

Viral MIP-II Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
DCTN3 Protein Lysate
OCOA02713-20UG 20 µg

DCTN3 Protein Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal HMCES Antibody [Alexa Fluor 750]
NBP3-18495AF750 0.1 mL

Rabbit Polyclonal HMCES Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details