Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A5GMA8

Expression Region

1-351

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDVLDDWLKRDRFVFVGWSGILLFPTAYLAIGGWLTGTTFVTSWYTH GIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWAFVALHGAFA LIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQANTFKAFEPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eng Rabbit Polyclonal Antibody
DP3518 200 µg

Eng Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (Azide free) (HRP)
MBS6356871-01 0.2 mL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (Azide free) (HRP)
MBS6356871-02 5x 0.2 mL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR242W (YGR242W)
MBS1053530 Inquire

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR242W (YGR242W)

Sign In for Pricing
View Details
(S) - (-) -Dropropizine-d4
sc-496929 2.5 mg

(S) - (-) -Dropropizine-d4

Sign In for Pricing
View Details
UV Blocking Shield for gelPRO and chemiPRO
UVSHIELD2530 1 Each

UV Blocking Shield for gelPRO and chemiPRO

Sign In for Pricing
View Details