Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acaryochloris marina Photosystem II D2 protein 2 (psbD2)

This Recombinant Acaryochloris marina Photosystem II D2 protein 2 (psbD2) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein 2, PSII D2 protein 2, EC= 1.10.3.9, Photosystem Q (A) protein 2

UniProt

B0C3P0

Expression Region

1-351

Origin

Acaryochloris marina (strain MBIC 11017)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVALGRVQERGWFDVLDDWLKRDRFVFIGWSGLLLFPCAFLSIGGWFTGTTFVTSWYTH GLASSYLEGCNFLTAAVSTPADSMGHSLLLLWGPEARGDFTRWCQLGGMWNFVTLHGAFG LIGFMLRQFEIARLVNVRPYNAVAFSGPIAVFVSVFLMYPLGQSSWFFAPSWGVASIFRF LLFVQGFHNLTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDTKDANTFSGFSPTQSE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWASAIGLVGIALNMRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGLRAWMAPQDQIHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF568 conjugate, 0.1mg/mL
BNC682078-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL
BNC040416-100 1x 100 µL

Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL
BNC742038-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details