Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q0QZ08

Expression Region

1-351

Origin

Synechococcus phage syn9

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTLQAPTRGWFDVLDDWLKRDRFVFVGWSGLLLFPTAYLAIGGWLTGTTFVTSWYTH GLASSYLEGANFLTAAVSTPADAMGHSLLLLWGPESQGDFIRWCQLGGLWAFVALHGAFA LIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLSAIHGVTVENTLYEDGEQANTFKAFDTTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EVRAAEDPEFETFYTKNILLNEGLRAWMAPVDQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PGPEP1L activation kit by CRISPRa
GA115535 1 Kit

Human PGPEP1L activation kit by CRISPRa

Sign In for Pricing
View Details
Hoechst 33342, 10mg/mL in H2O
#40046 1x 10 mL

Hoechst 33342, 10mg/mL in H2O

Sign In for Pricing
View Details
Chk1 (CHEK1) Mouse Monoclonal Antibody [Clone ID: 2G1D5]
AM06099PU-N 100 µL

Chk1 (CHEK1) Mouse Monoclonal Antibody [Clone ID: 2G1D5]

Sign In for Pricing
View Details
Human Thrombospondin 3 (THBS3) ELISA Kit
RDR-THBS3-Hu-01 96 Tests

Human Thrombospondin 3 (THBS3) ELISA Kit

Sign In for Pricing
View Details
Human Thrombospondin 3 (THBS3) ELISA Kit
RDR-THBS3-Hu-02 48 Tests

Human Thrombospondin 3 (THBS3) ELISA Kit

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) pThr187 Rabbit Polyclonal Antibody
AP12669PU-N 400 µL

p27 KIP 1 (CDKN1B) pThr187 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details