Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q0QZ08

Expression Region

1-351

Origin

Synechococcus phage syn9

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTLQAPTRGWFDVLDDWLKRDRFVFVGWSGLLLFPTAYLAIGGWLTGTTFVTSWYTH GLASSYLEGANFLTAAVSTPADAMGHSLLLLWGPESQGDFIRWCQLGGLWAFVALHGAFA LIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLSAIHGVTVENTLYEDGEQANTFKAFDTTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EVRAAEDPEFETFYTKNILLNEGLRAWMAPVDQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf36 (YAE1D1) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
CF808616 100 µg

C7orf36 (YAE1D1) Mouse Monoclonal Antibody [Clone ID: OTI1E7]

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL
BNC473092-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP-2 Recombinant Rabbit monoclonal Antibody
HA751405 100 µL

MMP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(Z)-2-((2-Ethoxy-2-oxoethoxy)imino)-2-(2-formamidothiazol-4-yl)acetic Acid
TRC-C179940-10MG 10 mg

(Z)-2-((2-Ethoxy-2-oxoethoxy)imino)-2-(2-formamidothiazol-4-yl)acetic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS804568 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
rac Metanephrine Hydrochloride Salt
TRC-M258760-50MG 50 mg

rac Metanephrine Hydrochloride Salt

Sign In for Pricing
View Details