Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Gap junction alpha-4 protein (gja4)

This Recombinant Xenopus tropicalis Gap junction alpha-4 protein (gja4) spans the amino acid sequence from region 2-352.

Product Specifications

Product Name Alternative

Gap junction alpha-4 protein, Connexin-41, Cx41

UniProt

Q0V990

Expression Region

2-352

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWEFLEKLLDQVQEHSTSIGKIWLMVLFIFRILILGLAGESVWGDEQSDFICNTEQPGC TNVCYDKAFPISHVRYWVLQFLFVSTPTLFYLGHVIYLSRREEKLKQKESELRALDDKEQ VEQAIAIIEKKKMKLYIQEDGTVKIKGALMCTYLTSVIFKSLFEAGFLLGQWYLYGFVMT PIYVCERVPCPHKVDCFVSRPMEKTIFIVFMLVVSLISLFLNVLELIHLVCKSMIDTLKK YSPYVPPNRYPKNEDTYPEKTSETATAPFQDKSYIYLPMNDNISYPQYKMPNEQNWANFN TEHQLAISGNNQSPLGHYSLSAFVPVPPKTHSTMEKPSTRASSSASKKQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-100 1x 100 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details