Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q1XDD0

Expression Region

1-351

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGQEKTRGGFDLVDDWLKRDRFVFVGWSGLLLFPCAYLAVGGWLTGTTFVTSWYTH GLASSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQIGGLWAFIALHGSFG LIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLMYPLGQASWFFAPSLGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVQNTLFEDGDAADTFRAFTPTQSE ETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAFGIVGLALNLRAYDFVSQ ELRAAEDPEFETFYTKIILXDEGIRSWMAAQDQPHENFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-3 Recombinant Rabbit monoclonal Antibody
HA723684 100 µL

Mouse IL-3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1804-01 50 μL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1804-02 100 µL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1804-03 1 mL

L1CAM Antibody

Sign In for Pricing
View Details
DL-Lauroylcarnitine Chloride
TRC-L184720-50MG 50 mg

DL-Lauroylcarnitine Chloride

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb1801), CF740 conjugate, 0.1mg/mL
BNC741916-500 1x 500 µL

P53 Tumor Suppressor Protein (PAb1801), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details