Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative hemin transport system permease protein hrtB (hrtB)

This Recombinant Staphylococcus aureus Putative hemin transport system permease protein hrtB (hrtB) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Putative hemin transport system permease protein hrtB

UniProt

Q2YZ25

Expression Region

1-351

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNVQTLKLSNKEQDVITMNDVKQQRLQLKKGD YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS FMMTVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3A (NM_002866) Human 3' UTR Clone
SC209011 10 µg

RAB3A (NM_002866) Human 3' UTR Clone

Sign In for Pricing
View Details
DFNA61 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0589607 1.0 µg DNA

DFNA61 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-NCL-MycG4/G-quadruplex complex Antibody (NG14)
YP380083-01 50 µg

Anti-NCL-MycG4/G-quadruplex complex Antibody (NG14)

Sign In for Pricing
View Details
Anti-NCL-MycG4/G-quadruplex complex Antibody (NG14)
YP380083-02 100 µg

Anti-NCL-MycG4/G-quadruplex complex Antibody (NG14)

Sign In for Pricing
View Details
Anti-NCL-MycG4/G-quadruplex complex Antibody (NG14)
YP380083-03 1 mg

Anti-NCL-MycG4/G-quadruplex complex Antibody (NG14)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPBC14F5.01 Polyclonal Antibody
MBS7183586 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPBC14F5.01 Polyclonal Antibody

Sign In for Pricing
View Details