Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative hemin transport system permease protein hrtB (hrtB)

This Recombinant Staphylococcus aureus Putative hemin transport system permease protein hrtB (hrtB) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Putative hemin transport system permease protein hrtB

UniProt

Q2YZ25

Expression Region

1-351

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNVQTLKLSNKEQDVITMNDVKQQRLQLKKGD YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS FMMTVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-2
CC037-050 50 µg

Recombinant Human Interleukin-2

Sign In for Pricing
View Details
OR4A14P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
35146111 3x 1.0 µg

OR4A14P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
FLASK RB, 1 CN 34/35 & 1 PSN 19/26 I/C J
4382A31 2 Units

FLASK RB, 1 CN 34/35 & 1 PSN 19/26 I/C J

Sign In for Pricing
View Details
FREM1 Protein Vector (Mouse) (pPM-C-HA)
PV180284 500 ng

FREM1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cat E3 Ubiquitin-Protein Ligase RING1 (RING1) ELISA Kit
MBS9915873 Inquire

Cat E3 Ubiquitin-Protein Ligase RING1 (RING1) ELISA Kit

Sign In for Pricing
View Details
YAP1 Recombinant Rabbit mAb, Bio conjugated
orb3001036 100 µL

YAP1 Recombinant Rabbit mAb, Bio conjugated

Sign In for Pricing
View Details