Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem II D2 protein (psbD1)

This Recombinant Anabaena variabilis Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q3MA59

Expression Region

1-351

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPSRGWFDVLDDWLKRDRFVFVGWSGILLFPCAFLALGGWLTGTTFVTSWYTH GLASSYLEGANFLTVAVSSPADSMGHSLLLLWGPEAQGDFTRWCQLGGLWPFVALHGAFG LIGFMLRQFEIARLVGIRPYNALAFSAPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGEGANTFRAFNPTQSE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAVGIVGLALNLRAYDFVSQ ELRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Asah1 activation kit by CRISPRa
GA200295 1 Kit

Mouse Asah1 activation kit by CRISPRa

Sign In for Pricing
View Details
HRP Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-
H-8003-1 1 mg

HRP Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-

Sign In for Pricing
View Details
Aoc3 Mouse Gene Knockout Kit (CRISPR)
KN501345 1 Kit

Aoc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S6K1 (RPS6KB1) pSer424 Rabbit Polyclonal Antibody
AP02525PU-N 100 µL

S6K1 (RPS6KB1) pSer424 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX9 Rabbit Polyclonal Antibody
AP11363PU-N 400 µL

SOX9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Psoralen TMP Alkyne
39063-AAT 1 mg

Psoralen TMP Alkyne

Sign In for Pricing
View Details