Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q3AH25

Expression Region

1-351

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDVLDDWLKRDRFVFVGWSGILLLPTAYLAIGGWLTGTTFVTSWYTH GIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWAFVALHGAFA LIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQANTFKAFEPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Riboflavin kinase, Recombinant Human (RIFK, RP11-422N19.2, RFK)
MBS636310-01 0.1 mg

Riboflavin kinase, Recombinant Human (RIFK, RP11-422N19.2, RFK)

Sign In for Pricing
View Details
Riboflavin kinase, Recombinant Human (RIFK, RP11-422N19.2, RFK)
MBS636310-02 5x 0.1 mg

Riboflavin kinase, Recombinant Human (RIFK, RP11-422N19.2, RFK)

Sign In for Pricing
View Details
Rabbit Monoclonal Hemoglobin A1 Antibody (1R1N7)
NBP3-16804-100ul 100 µL

Rabbit Monoclonal Hemoglobin A1 Antibody (1R1N7)

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) CLIA Kit
abx495729-01 96 Tests

Human Biliverdin Reductase B (BLVRB) CLIA Kit

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) CLIA Kit
abx495729-02 5x 96 Tests

Human Biliverdin Reductase B (BLVRB) CLIA Kit

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) CLIA Kit
abx495729-03 10x 96 Tests

Human Biliverdin Reductase B (BLVRB) CLIA Kit

Sign In for Pricing
View Details