Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fatty acid desaturase (desA)

This Recombinant Fatty acid desaturase (desA) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Fatty acid desaturase, EC= 1.14.19.-, Delta (12) -desaturase

UniProt

Q54794

Expression Region

1-351

Origin

Spirulina platensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLSIVKSEDSSSRPSAVPSDLPLEEDIINTLPSGVFVQDRYKAWMTVIINVVMVGLGWL GIAIAPWFLLPVVWVFTGTALTGFFVIGHDCGHRSFSRNVWVNDWVGHILFLPIIYPFHS WRIGHNQHHKYTNRMELDNAWQPWRKEEYQNAGKFMQVTYDLFRGRAWWIGSILHWASIH FDWTKFEGKQRQQVKFSSLLVIGAAAIAFPTMILTIGVWGFVKFWVIPWLVFHFWMSTFT LLHHTIADIPFREPEQWHEAESQLSGTVHCNYSRWGEFLCHDINVHIPHHVTTAIPWYNL RTPTPVYRKIGGEYLYPECDFSWGLMKQVVDHAICMMRITIISQSLTTKRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details