Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Rod outer segment membrane protein 1 (Rom1)

This Recombinant Rat Rod outer segment membrane protein 1 (Rom1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Rod outer segment membrane protein 1, ROSP1

UniProt

Q5PPM7

Expression Region

1-351

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPVLPVVLPLQPRIRLAQGTWLLSWLLALAGGLTLLCSGHLLVQLWHLGTFLAPSCSFP ALPQTALAAGAVALGTGLGGAGASRASLDAAQYPPWRGVLTPLLVVGTAAGGGLLTLGLG LALALPVSLHQGLEEGLQAALAHYKDTEVPGHCQAKRLMDELQLRYHCCGRHGYKDWFGV QWVSSRYLDPNDQDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFD PRQPNLNLWAQGCHEVLVGHLQGLSGTLGSILAVTLLLQVLVLLGLRYLQTALEGLGGVI DGEGETQGYLLPGGLKDILQTAWLQGGLAHKPAPEEAPPDEEPPKEVLAEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf139 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0282107 1.0 µg DNA

C10orf139 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mycoplasma pneumoniae P1
PR-BA127VSP1-L 1 mg

Mycoplasma pneumoniae P1

Sign In for Pricing
View Details
Nicorandil Impurity 53
RM-N031880-01 10 mg

Nicorandil Impurity 53

Sign In for Pricing
View Details
Nicorandil Impurity 53
RM-N031880-02 25 mg

Nicorandil Impurity 53

Sign In for Pricing
View Details
Nicorandil Impurity 53
RM-N031880-03 50 mg

Nicorandil Impurity 53

Sign In for Pricing
View Details
Nicorandil Impurity 53
RM-N031880-04 100 mg

Nicorandil Impurity 53

Sign In for Pricing
View Details