Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Rod outer segment membrane protein 1 (Rom1)

This Recombinant Rat Rod outer segment membrane protein 1 (Rom1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Rod outer segment membrane protein 1, ROSP1

UniProt

Q5PPM7

Expression Region

1-351

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPVLPVVLPLQPRIRLAQGTWLLSWLLALAGGLTLLCSGHLLVQLWHLGTFLAPSCSFP ALPQTALAAGAVALGTGLGGAGASRASLDAAQYPPWRGVLTPLLVVGTAAGGGLLTLGLG LALALPVSLHQGLEEGLQAALAHYKDTEVPGHCQAKRLMDELQLRYHCCGRHGYKDWFGV QWVSSRYLDPNDQDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFD PRQPNLNLWAQGCHEVLVGHLQGLSGTLGSILAVTLLLQVLVLLGLRYLQTALEGLGGVI DGEGETQGYLLPGGLKDILQTAWLQGGLAHKPAPEEAPPDEEPPKEVLAEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBG1/2 Rabbit pAb
E2381738 100 µL

HBG1/2 Rabbit pAb

Sign In for Pricing
View Details
Hydrochloric acid fuming 37 % p.A., ACS
LC-7093.2GL 2.5 L

Hydrochloric acid fuming 37 % p.A., ACS

Sign In for Pricing
View Details
Anti-GD2 Reference Antibody (EMD 273063)
MBS9247734-01 0.1 mg

Anti-GD2 Reference Antibody (EMD 273063)

Sign In for Pricing
View Details
Anti-GD2 Reference Antibody (EMD 273063)
MBS9247734-02 5x 0.1 mg

Anti-GD2 Reference Antibody (EMD 273063)

Sign In for Pricing
View Details
Mmu-miR-493-5p miRNA Mimic
CMM0989-01 5 nmol

Mmu-miR-493-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-493-5p miRNA Mimic
CMM0989-02 10 nmol

Mmu-miR-493-5p miRNA Mimic

Sign In for Pricing
View Details