Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative hemin transport system permease protein hrtB (hrtB)

This Recombinant Staphylococcus aureus Putative hemin transport system permease protein hrtB (hrtB) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Putative hemin transport system permease protein hrtB

UniProt

Q6GE74

Expression Region

1-351

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM KEPQIEKSQLSDTQQNQIKKVIHQESYKMNIQTLKLSNKEQDVITMNDVKQQRIQLKKGD YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYSHSSIVLLNDNGFNA LNKVNTAFYPVKNLTQQQRDELNKINDVQVVNEKDLTDNIASYQAEQAPLNMMIVSLFAI TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS FMMPVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Deep Well Plates
D3048-01S 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Txndc8 Mouse Gene Knockout Kit (CRISPR)
KN518515 1 Kit

Txndc8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF488A conjugate, 0.1mg/mL
BNC881807-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XKR4 Human Gene Knockout Kit (CRISPR)
KN418548 1 Kit

XKR4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Over-expression Lysate
LY429270 100 µg

Peroxiredoxin 2 (PRDX2) (NM_005809) Human Over-expression Lysate

Sign In for Pricing
View Details
Pheniramine Maleate
TRC-P297200-50MG 50 mg

Pheniramine Maleate

Sign In for Pricing
View Details