Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q6H956

Expression Region

1-351

Origin

Synechococcus phage S-RSM2

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASNLTLQQRGWFDVLDDWLKRDRFVFVGWSGLLLFPTAYLAIGGWLTGTTFVTSWYTH GLASSYLEGANFLTAAVSTPADAMGHSLLLLWGPEAQGDFIRWCQLGGLWAFVALHGAFA LIGFMLRQFELARLIGIRPYNAIAFSGPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLSAIHGVTVENTLYQDGEQANTFKAFDSTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EIRASEDPEFETFYTKNILLNEGLRAWLAPVDQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Fetuin B Protein (His Tag)
PDMM100141-01 20 µg

Recombinant Mouse Fetuin B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fetuin B Protein (His Tag)
PDMM100141-02 100 µg

Recombinant Mouse Fetuin B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fetuin B Protein (His Tag)
PDMM100141-03 500 µg

Recombinant Mouse Fetuin B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fetuin B Protein (His Tag)
PDMM100141-04 1 mg

Recombinant Mouse Fetuin B Protein (His Tag)

Sign In for Pricing
View Details
Tmem161b Mouse Gene Knockout Kit (CRISPR)
KN517745 1 Kit

Tmem161b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OGG1 (C-term) Rabbit Polyclonal Antibody
AP17606PU-N 400 µL

OGG1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details