Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q7TTI2

Expression Region

1-351

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDILDDWLKRDRFVFVGWSGILLFPTAYLAIGGWLTGTTFVTSWYTH GIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWAFVALHGAFA LIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQANTFKAFEPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-mouse CD23
E16FMU023-500U 500 µg

Purified anti-mouse CD23

Sign In for Pricing
View Details
AICDA Over-expression Lysate Product
GWB-AA2BA9 0.1 mg

AICDA Over-expression Lysate Product

Sign In for Pricing
View Details
Bovine General Transcription And Dna Repair Factor Iih Helicase Subunit Xpd (ERCC2) ELISA Kit-Sandwich
EK2F388-01 48 Test

Bovine General Transcription And Dna Repair Factor Iih Helicase Subunit Xpd (ERCC2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine General Transcription And Dna Repair Factor Iih Helicase Subunit Xpd (ERCC2) ELISA Kit-Sandwich
EK2F388-02 96 Tests

Bovine General Transcription And Dna Repair Factor Iih Helicase Subunit Xpd (ERCC2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
C11ORF77 (HARBI1) Human qPCR Template Standard (NM_173811)
HK212133 1 Kit

C11ORF77 (HARBI1) Human qPCR Template Standard (NM_173811)

Sign In for Pricing
View Details
TDP-43/TARDB polyclonal antibody
BS6221-01 50 µL

TDP-43/TARDB polyclonal antibody

Sign In for Pricing
View Details