Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q7TTI2

Expression Region

1-351

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDILDDWLKRDRFVFVGWSGILLFPTAYLAIGGWLTGTTFVTSWYTH GIASSYLEGCNFLTAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWAFVALHGAFA LIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEQANTFKAFEPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAT2 shRNA (UAS) - Lentiviral human FAT2 shRNA (UAS) (25)
GTR15343556 1 Vial

Lentiviral human FAT2 shRNA (UAS) - Lentiviral human FAT2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rat DNA ligase 1 ELISA Kit
MBS2884079-01 48 Well

Rat DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Rat DNA ligase 1 ELISA Kit
MBS2884079-02 96 Well

Rat DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Rat DNA ligase 1 ELISA Kit
MBS2884079-03 5x 96 Well

Rat DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Rat DNA ligase 1 ELISA Kit
MBS2884079-04 10x 96 Well

Rat DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Leucine--tRNA ligase (leuS), partial
MBS1209231 Inquire

Recombinant Desulfobacterium autotrophicum Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details