Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0421 protein BC_2748 (BC_2748)

This Recombinant Bacillus cereus UPF0421 protein BC_2748 (BC_2748) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

UPF0421 protein BC_2748

UniProt

Q81CK9

Expression Region

1-351

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQDRKWNIVGGRVIKTGIAVFLTVLVCDFFNIPTIFAVITAIVTIEPTATDSIKKGLIR FPASTIGSAYAMTFTFFLGHQAISYALAAMFTIVACQKLRLHAGTLVATLTAVAMIPITA NHYFTAFLIRLATTSTGIIVSTLVNFFIFPPHYTKMIFGCTEDLFAKTANIMEEWITALV AGKGVKKETAQDLSKLTLLLHKAIQFVQYEQKDWKYHQHTKKEMRSFLTMQKQLHILQQI IYHIDNLARVSIETCDWSQSEREILQRTIHSIIAILRNRCNEIDEEHFKLIAELDKQFWS YKNDLKDYKPNHYHHHFSSESIILFEVLSIHDMLEELKQISEKYEWENRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF640R conjugate, 0.1mg/mL
BNC402729-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF740 conjugate, 0.1mg/mL
BNC740167-500 1x 500 µL

GFAP (GA-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details